GET /api/protein/UniProt/A0A6J2EUB6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2EUB6",
        "id": "A0A6J2EUB6_ZALCA",
        "source_organism": {
            "taxId": "9704",
            "scientificName": "Zalophus californianus",
            "fullName": "Zalophus californianus (California sealion)"
        },
        "name": "Frataxin, mitochondrial",
        "description": [
            "Modulates the RNA-binding activity of ACO1. May be involved in the cytoplasmic iron-sulfur protein biogenesis. May contribute to oxidative stress resistance and overall cell survival"
        ],
        "length": 187,
        "sequence": "MTRPALPSSGSIQQSCVTSGDLEPLRGLASFSSLSLHRLDQIVNVKKQSVCLMNMRTVGTLGDPGFLDETTYERLAEKTLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYAHDGMSLHELLATELTKALKTKLDLSSLAYSGKGA",
        "proteome": "UP000515165",
        "gene": "FXN",
        "go_terms": [
            {
                "identifier": "GO:0008199",
                "name": "ferric iron binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004322",
                "name": "ferroxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006879",
                "name": "intracellular iron ion homeostasis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0018283",
                "name": "iron incorporation into metallo-sulfur cluster",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005739",
                "name": "mitochondrion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "96609387cf62d52e72e9042629221ecfc2cf7b97",
        "counters": {
            "domain_architectures": 8959,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "ncbifam": 2,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8959
        }
    }
}