HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2EUB6",
"id": "A0A6J2EUB6_ZALCA",
"source_organism": {
"taxId": "9704",
"scientificName": "Zalophus californianus",
"fullName": "Zalophus californianus (California sealion)"
},
"name": "Frataxin, mitochondrial",
"description": [
"Modulates the RNA-binding activity of ACO1. May be involved in the cytoplasmic iron-sulfur protein biogenesis. May contribute to oxidative stress resistance and overall cell survival"
],
"length": 187,
"sequence": "MTRPALPSSGSIQQSCVTSGDLEPLRGLASFSSLSLHRLDQIVNVKKQSVCLMNMRTVGTLGDPGFLDETTYERLAEKTLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYAHDGMSLHELLATELTKALKTKLDLSSLAYSGKGA",
"proteome": "UP000515165",
"gene": "FXN",
"go_terms": [
{
"identifier": "GO:0008199",
"name": "ferric iron binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016226",
"name": "iron-sulfur cluster assembly",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004322",
"name": "ferroxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006879",
"name": "intracellular iron ion homeostasis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0018283",
"name": "iron incorporation into metallo-sulfur cluster",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005739",
"name": "mitochondrion",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "96609387cf62d52e72e9042629221ecfc2cf7b97",
"counters": {
"domain_architectures": 8959,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"smart": 1,
"panther": 1,
"ncbifam": 2,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8959
}
}
}