GET /api/protein/UniProt/A0A6J2DT88/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2DT88",
        "id": "A0A6J2DT88_ZALCA",
        "source_organism": {
            "taxId": "9704",
            "scientificName": "Zalophus californianus",
            "fullName": "Zalophus californianus (California sealion)"
        },
        "name": "Peroxisomal targeting signal 2 receptor",
        "description": [
            "Receptor required for the peroxisomal import of proteins containing a C-terminal PTS2-type peroxisomal targeting signal. Specifically binds to cargo proteins containing a PTS2 peroxisomal targeting signal in the cytosol. Cargo protein-binding triggers interaction with PEX5 and formation of a ternary complex composed of PEX5 and PEX7 along with PTS2-containing cargo proteins, which is tranlocated into peroxisomes by passing through the PEX13-PEX14 docking complex"
        ],
        "length": 323,
        "sequence": "MSGARGGAVRTLRVPGRHGYAAEFSPYLPGRLACAAAQHYGIAGCGTLLILDQNESGLRLFRSFDWNDGLFDVTWSENNEHVLVTCSGDGSLQLWDTAKAAGPLQVYKEHTQEVYSVDWSQTRGEQLVVSGSWDQTVKLWDPTVGRSLCTFRGHEGVIYSTIWSPHIPGCFASASGDQTLRIWDVKSTGVRIVVPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAVRRVKFSPSHASVLATCSYDFTVRFWNFSKPDPLLETVEHHTEFTCGLDLSLQSPTQVADCAWDETIKIYDPVCLTMPA",
        "proteome": "UP000515165",
        "gene": "PEX7",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005053",
                "name": "peroxisome matrix targeting signal-2 binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016558",
                "name": "protein import into peroxisome matrix",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4e79db4b42d66a7d75ea58177bc00fb0ad4e2d3f",
        "counters": {
            "domain_architectures": 30708,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "profile": 2,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30708
        }
    }
}