GET /api/protein/UniProt/A0A6J2D879/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2D879",
        "id": "A0A6J2D879_ZALCA",
        "source_organism": {
            "taxId": "9704",
            "scientificName": "Zalophus californianus",
            "fullName": "Zalophus californianus (California sealion)"
        },
        "name": "Galectin",
        "description": [
            "Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans"
        ],
        "length": 365,
        "sequence": "MAFCEANQQQDPSLARASVSIWEPLNETCLKSTSYVEERPQSTTRWKRVMLSLTNLQNIIYNPVIPYVGTIPGELEPGTLIVIRGHVPCDSDRFQVDLQCGSSVKPRADVAFHFNPRFKWSNCIVCNTLKNEKWGWEEITYDVPFKKEKSFEIVMMVLKDKFQVAVNGKHTLLYAHRISPGKIDTLGIYGKVNVHSVGYSFSSDFRSTQASILELTEISKENVLKSDTPHFTLPFTARLNSSMGPGRTVFIKGEVNKTAKGFNVNLVSGKSKDIALHLNPRLNIKAFVRNSFLHESWGEEERNITCFPFSPGMYFEMIIYCDAREFKVAVNGVHSLEYKHRFKELSDIDTLEIDGDIHLLEVRSW",
        "proteome": "UP000515165",
        "gene": "LGALS8",
        "go_terms": [
            {
                "identifier": "GO:0030246",
                "name": "carbohydrate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ffbb8fdb6dace06ffe9c196dae065f4979c74328",
        "counters": {
            "domain_architectures": 5613,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 2,
                "cdd": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5613
        }
    }
}