GET /api/protein/UniProt/A0A6J2D879/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2D879",
"id": "A0A6J2D879_ZALCA",
"source_organism": {
"taxId": "9704",
"scientificName": "Zalophus californianus",
"fullName": "Zalophus californianus (California sealion)"
},
"name": "Galectin",
"description": [
"Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans"
],
"length": 365,
"sequence": "MAFCEANQQQDPSLARASVSIWEPLNETCLKSTSYVEERPQSTTRWKRVMLSLTNLQNIIYNPVIPYVGTIPGELEPGTLIVIRGHVPCDSDRFQVDLQCGSSVKPRADVAFHFNPRFKWSNCIVCNTLKNEKWGWEEITYDVPFKKEKSFEIVMMVLKDKFQVAVNGKHTLLYAHRISPGKIDTLGIYGKVNVHSVGYSFSSDFRSTQASILELTEISKENVLKSDTPHFTLPFTARLNSSMGPGRTVFIKGEVNKTAKGFNVNLVSGKSKDIALHLNPRLNIKAFVRNSFLHESWGEEERNITCFPFSPGMYFEMIIYCDAREFKVAVNGVHSLEYKHRFKELSDIDTLEIDGDIHLLEVRSW",
"proteome": "UP000515165",
"gene": "LGALS8",
"go_terms": [
{
"identifier": "GO:0030246",
"name": "carbohydrate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ffbb8fdb6dace06ffe9c196dae065f4979c74328",
"counters": {
"domain_architectures": 5613,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 2,
"cdd": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5613
}
}
}