GET /api/protein/UniProt/A0A6J2CSS5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2CSS5",
"id": "A0A6J2CSS5_ZALCA",
"source_organism": {
"taxId": "9704",
"scientificName": "Zalophus californianus",
"fullName": "Zalophus californianus (California sealion)"
},
"name": "Ribonuclease H2 subunit B",
"description": [
"Non catalytic subunit of RNase H2, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes"
],
"length": 313,
"sequence": "MDCGNGARARQHVFLLPEYLKDASKKMKSGLMFVKLVNPCSGEGTIYLFNMCLQQLFEIKIFKEKHHSWFINQSVQSGGLLHFATPMDPLFLLLHYLRKADKEGKFQPLEQVVVDDMFPNCILLLKLPDLEKLLRHVTEEKEIDKKKYYKYSKEKTIKWLEIKVHQTVSALKTNNVNVGARVQATAFFSGDQVSIDKEEDYIRYAHGLISDYIPKELSDDLSKYLKLPEPSASLPNPPSKKVKLSDEPVEAKEDYTKFNRTDWKTEKKNSKMTAAQKALAKVDKSGMKSGSTKTEKGQVTAGPTQSLAASSIT",
"proteome": "UP000515165",
"gene": "RNASEH2B",
"go_terms": [
{
"identifier": "GO:0032299",
"name": "ribonuclease H2 complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ba11c6980a1465952d79f718ac47cdf58655b1f",
"counters": {
"domain_architectures": 3711,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"pfam": 2,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3711
}
}
}