GET /api/protein/UniProt/A0A6J2CRE0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2CRE0",
        "id": "A0A6J2CRE0_ZALCA",
        "source_organism": {
            "taxId": "9704",
            "scientificName": "Zalophus californianus",
            "fullName": "Zalophus californianus (California sealion)"
        },
        "name": "D-2-hydroxyglutarate dehydrogenase, mitochondrial",
        "description": [
            "Catalyzes the oxidation of D-2-hydroxyglutarate (D-2-HG) to alpha-ketoglutarate. Also catalyzes the oxidation of other D-2-hydroxyacids, such as D-malate (D-MAL) and D-lactate (D-LAC). Exhibits high activities towards D-2-HG and D-MAL but a very weak activity towards D-LAC"
        ],
        "length": 477,
        "sequence": "MPGSGSRAARPGPLSPMCPSTPLLEAETSLPHPGRHLCSWTRPGLGPSWASSVVFQSCRSCHLLFRAGAMVPHLVPRQLVRLFRWQVACARGASVQPRTWAAASRIPSLLSPWGAMGTSRLVCRSSSSTSPCAPEVVLTQERYPVTRLPFSVVSEEDLEAFERIIPGRVVTDPEVLEASNVDWLRTVRGGSKVLLRPRTSQEVAHILRYCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTAQMNQVISFHSVSGTLVCQAGCVLEELSRYVEERGFVMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTILNCLTSLRKDNTGYDLKQLFIGSEGTLGVITAVSIQCPPKPTAVNVAFLGCPGFAEVLQTFSSCRGLLGEILSAYEFMDAECMRLVTHHLCLTSPVQESPFYVLIETSGSRAEHDAEKLSDFLEQVLSSGLVTDGTVATDQMKLKGMVTCT",
        "proteome": "UP000515165",
        "gene": "D2HGDH",
        "go_terms": [
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071949",
                "name": "FAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b22dd38be3a0e6997fe24cb0e6fe943f209805a",
        "counters": {
            "domain_architectures": 57688,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "profile": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 57688
        }
    }
}