GET /api/protein/UniProt/A0A6J2CL12/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2CL12",
"id": "A0A6J2CL12_ZALCA",
"source_organism": {
"taxId": "9704",
"scientificName": "Zalophus californianus",
"fullName": "Zalophus californianus (California sealion)"
},
"name": "DNA-directed RNA polymerase II subunit RPB4",
"description": [
"Core component of RNA polymerase II (Pol II), a DNA-dependent RNA polymerase which synthesizes mRNA precursors and many functional non-coding RNAs using the four ribonucleoside triphosphates as substrates. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. POLR2D/RPB4 is part of a subcomplex with POLR2G/RPB7 that binds to a pocket formed by POLR2A/RPB1, POLR2B/RPB2 and POLR2F/RPABC2 at the base of the clamp element. The POLR2D/RPB4-POLR2G/RPB7 subcomplex seems to lock the clamp via POLR2G/RPB7 in the closed conformation thus preventing double-stranded DNA to enter the active site cleft. The POLR2D/RPB4-POLR2G/RPB7 subcomplex binds single-stranded DNA and RNA"
],
"length": 142,
"sequence": "MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY",
"proteome": "UP000515165",
"gene": "POLR2D",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006352",
"name": "DNA-templated transcription initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030880",
"name": "RNA polymerase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "00ff8f23a337786e25d53a90c9e5a62021b5c458",
"counters": {
"domain_architectures": 9806,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"panther": 1,
"pfam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9806
}
}
}