General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2BNI9",
        "id": "A0A6J2BNI9_ZALCA",
        "source_organism": {
            "taxId": "9704",
            "scientificName": "Zalophus californianus",
            "fullName": "Zalophus californianus (California sealion)"
        },
        "name": "Proton-coupled zinc antiporter SLC30A2",
        "description": [
            "Electroneutral proton-coupled antiporter concentrating zinc ions into a variety of intracellular organelles including endosomes, zymogen granules and mitochondria. Thereby, plays a crucial role in cellular zinc homeostasis to confer upon cells protection against its potential cytotoxicity. Regulates the zinc concentration of milk, through the transport of zinc ions into secretory vesicles of mammary cells. By concentrating zinc ions into lysosomes participates to lysosomal-mediated cell death during early mammary gland involution"
        ],
        "length": 355,
        "sequence": "MEPTEKQHLVDARPGARSYTGSLWQEGTGWIPLPPSGLDLQAIELVTENNHYCHAQKGPGSHFDPMKERARRQLYVASAICLVFMIGEVVGGYLAHSLAVMTDAAHLLTDFASMLVSLFSLWMSSRPATKTMNFGWQRAEILGALLSVLSIWVVTGVLVFLAVERLISGDYEIEGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHDTGQQQENPSVRAAFIHVIGDFLQSIGILVAAYILYFKPEYKYVDPICTFLFSILVLGTTLTILRDVLLVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIECRWPGCAEGSQHPPAGQVPLPHHDHPDRRLL",
        "proteome": "UP000515165",
        "gene": "SLC30A2",
        "go_terms": [
            {
                "identifier": "GO:0008324",
                "name": "monoatomic cation transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006812",
                "name": "monoatomic cation transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b102d6e427d8516f3007f76e7d0e9c0b51265ff5",
        "counters": {
            "domain_architectures": 59537,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 59537
        }
    }
}