General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2AGF8",
        "id": "A0A6J2AGF8_ACIJB",
        "source_organism": {
            "taxId": "32536",
            "scientificName": "Acinonyx jubatus",
            "fullName": "Acinonyx jubatus (Cheetah)"
        },
        "name": "Calcitonin",
        "description": [
            "Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. Calcitonin function is mediated by the calcitonin receptor/CALCR and the CALCR-RAMP2 (AMYR2) receptor complex"
        ],
        "length": 137,
        "sequence": "MERGIMGFGKSSPFLAFSILVLCQAGSLQAAPFRSALESLPDPTTLSEKEGRLLLAALVKAYVQGKTNELEQEQEQEETEGSSLDSFRAKRCSNLSTCVLGAYSKDLNNFHTFSGIGFGAETPGKKRDIASSLEKGQ",
        "proteome": "UP001652583",
        "gene": "CALCB",
        "go_terms": [
            {
                "identifier": "GO:0005179",
                "name": "hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5d547907d6b832628699bd68149ea78b42a3fa12",
        "counters": {
            "domain_architectures": 4087,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4087
        }
    }
}