GET /api/protein/UniProt/A0A6J1YIB6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J1YIB6",
"id": "A0A6J1YIB6_ACIJB",
"source_organism": {
"taxId": "32536",
"scientificName": "Acinonyx jubatus",
"fullName": "Acinonyx jubatus (Cheetah)"
},
"name": "DnaJ homolog subfamily C member 7",
"description": [
"Acts as a co-chaperone regulating the molecular chaperones HSP70 and HSP90 in folding of steroid receptors, such as the glucocorticoid receptor and the progesterone receptor. Proposed to act as a recycling chaperone by facilitating the return of chaperone substrates to early stages of chaperoning if further folding is required. In vitro, induces ATP-independent dissociation of HSP90 but not of HSP70 from the chaperone-substrate complexes. Recruits NR1I3 to the cytoplasm"
],
"length": 494,
"sequence": "MAAAAECDVVMAATEPELLDDEEAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGKFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVIEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDGAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDANNIFKAFFGGPGGFSFEASGPGNFFFQFG",
"proteome": "UP001652583",
"gene": "DNAJC7",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1f80f8730201bcfba69c5feef4c1f164310a472c",
"counters": {
"domain_architectures": 354,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"smart": 2,
"profile": 3,
"pfam": 4,
"ssf": 2,
"cdd": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 354
}
}
}