General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J1VEN1",
        "id": "A0A6J1VEN1_9SAUR",
        "source_organism": {
            "taxId": "8663",
            "scientificName": "Notechis scutatus",
            "fullName": "Notechis scutatus (mainland tiger snake)"
        },
        "name": "Copper transport protein ATOX1",
        "description": [
            "Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense"
        ],
        "length": 68,
        "sequence": "MPKHEFFVDMTCEGCLNAVSRVLNKLGGVQFEIDLPNKKVSIDSTHSVDTLLETLKKTGKNTSYLGEK",
        "proteome": "UP000504612",
        "gene": "ATOX1",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "91d90ceccec4f7a952bc67ca1a5ca741c2b91ba0",
        "counters": {
            "domain_architectures": 59696,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 59696
        }
    }
}