HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J1VDB2",
"id": "A0A6J1VDB2_9SAUR",
"source_organism": {
"taxId": "8663",
"scientificName": "Notechis scutatus",
"fullName": "Notechis scutatus (mainland tiger snake)"
},
"name": "Biliverdin reductase A",
"description": [
"Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IXalpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor. Does not reduce bilirubin IXbeta. Uses the reactants NADH or NADPH depending on the pH; NADH is used at the acidic pH range (6-6.9) and NADPH at the alkaline range (8.5-8.7). NADPH, however, is the probable reactant in biological systems"
],
"length": 296,
"sequence": "MFGTVVIGIGIAGSVRIRDLLNPLPSSPAEHLKLLGFVSRRSLNEVYQVKQISLQEALDNPEIHAAIISTDNQNHTESVRKFLEAGKHVLVEYPLALSAKIAHEVWELAELKDKILHVEHIELLTEEYKQLKKEVSGKELVKGTLHFTGGPLDERYSGFPSFSGIARLTWLVDLFGDLTVTSATREQQKENNYFRMTVHFQTANKRPLTWIEERGPGMKRDKKINFCFKNGCLECLPEAPRSPVGLFMQDLIIFAKKLLGQIPKEELTAEKKRILLCLSLAEEIQMHCEAPSTFYS",
"proteome": "UP000504612",
"gene": "BLVRA",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004074",
"name": "biliverdin reductase [NAD(P)H] activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042167",
"name": "heme catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "807cb7f491ce4525417f61aaec49006ab219d444",
"counters": {
"domain_architectures": 998,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 998
}
}
}