GET /api/protein/UniProt/A0A6J1R3L3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J1R3L3",
        "id": "A0A6J1R3L3_9HYME",
        "source_organism": {
            "taxId": "300111",
            "scientificName": "Temnothorax curvispinosus",
            "fullName": "Temnothorax curvispinosus"
        },
        "name": "Vacuolar-sorting protein SNF8",
        "description": [
            "Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs"
        ],
        "length": 251,
        "sequence": "MRRKAGVGAIHKQKLEQEKYRDKGTEIQENQFEQMTKHMETFRVNLEEFASKHKSEIKKNARFRRQFTEMCASIGVDPLASGKGFWSVLGIGDFYYELAVQIVEVCMATNYKNGGLISLDELRTRLIQARGRRKEHQEITNEDLLAAAKKLKIFGNGFSVVPIGRGKHLVQSIPGELSMDHTAVLHQASLSANAYVSKSILCKELRWEEDRAQKALDHMMKEGLAWLDKQAEDETLYWFPSLFTACIVSTE",
        "proteome": "UP000504618",
        "gene": "LOC112466020",
        "go_terms": [
            {
                "identifier": "GO:0071985",
                "name": "multivesicular body sorting pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000814",
                "name": "ESCRT II complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fdb954cefd9f352e34528e60de206e99d1cecdba",
        "counters": {
            "domain_architectures": 5500,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5500
        }
    }
}