GET /api/protein/UniProt/A0A6J1N2B6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J1N2B6",
        "id": "A0A6J1N2B6_BICAN",
        "source_organism": {
            "taxId": "110368",
            "scientificName": "Bicyclus anynana",
            "fullName": "Bicyclus anynana (Squinting bush brown butterfly)"
        },
        "name": "Proteasome subunit alpha type",
        "description": [
            "The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity"
        ],
        "length": 257,
        "sequence": "MARRYDTRTTIFSPEGRLYQVEYAMEAISHAGTSLGILATDGILLAAERRNTNKLLDEVFFSEKIYKLNEDMVCSVAGITSDANVLTNELRLIAQRYLLQYGESIPCEQLVSWLCDVKQAYTQYGGKRPFGVSILYMGWDKHYGYQLYQSDPSGNYGGWKATCIGNNSAAAVSSLKQEYKENETTLAEAQALAIKVLSKTLDMTKLTPEKVEMATLTRKDNKTVIRVLSSAEVEKLIANFEKSEAEAEAAKKLQPKS",
        "proteome": "UP001652582",
        "gene": "LOC112045174",
        "go_terms": [
            {
                "identifier": "GO:0006511",
                "name": "ubiquitin-dependent protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019773",
                "name": "proteasome core complex, alpha-subunit complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005839",
                "name": "proteasome core complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b4fc3eb7060592e47b710df6e92c52ef7477efb8",
        "counters": {
            "domain_architectures": 29684,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 2,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29684
        }
    }
}