HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J1L2I4",
"id": "A0A6J1L2I4_DROHY",
"source_organism": {
"taxId": "7224",
"scientificName": "Drosophila hydei",
"fullName": "Drosophila hydei (Fruit fly)"
},
"name": "Superoxide dismutase",
"description": [
"Destroys radicals which are normally produced within the cells and which are toxic to biological systems",
"Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems"
],
"length": 217,
"sequence": "MFLARNFTKTARTVISRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEDAKCKSDTTKIIQLAPALRFNGGGHINHTIFWQNLSPEKSTPSDDLKKAIESQWKSFEEFKKELSALTVAVQGSGWGWLGYNKKTSKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIANWNDISCRYQEAKKLS",
"proteome": "UP000504633",
"gene": "LOC111592548",
"go_terms": [
{
"identifier": "GO:0004784",
"name": "superoxide dismutase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006801",
"name": "superoxide metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fd6207aea5eb2a91ae628a69adfab9df8e89ed4f",
"counters": {
"domain_architectures": 39182,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"pfam": 2,
"cathgene3d": 2,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 39182
}
}
}