GET /api/protein/UniProt/A0A6J0Y170/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J0Y170",
"id": "A0A6J0Y170_ODOVR",
"source_organism": {
"taxId": "9874",
"scientificName": "Odocoileus virginianus",
"fullName": "Odocoileus virginianus (White-tailed deer)"
},
"name": "Guanylate kinase",
"description": [
"Catalyzes the phosphorylation of GMP to GDP. Essential enzyme for recycling GMP and indirectly, cyclic GMP (cGMP). Involved in the cGMP metabolism in photoreceptors"
],
"length": 219,
"sequence": "MLRRPLAGLAAAALGRATSDGMSGPRPVVLSGPSGAGKSTLLKRLLQEHGSIFGFSVSHTTRDPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVRAVQAMNRICVLDVDLQGVRNIKKTDLRPIYIFVQPPSLDVLEQRLRQRNTETEESLAKRLAAARADMESSKEPGLFDLIIVNDSLDKAYWALKEALSEEIKKAQATGQS",
"proteome": "UP001652640",
"gene": "GUK1",
"go_terms": [
{
"identifier": "GO:0004385",
"name": "GMP kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006163",
"name": "purine nucleotide metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "891a21cb88c845cfc57f5efa3bae7c4c041a1453",
"counters": {
"domain_architectures": 37174,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"cathgene3d": 2,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 37174
}
}
}