General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J0X5Y3",
        "id": "A0A6J0X5Y3_ODOVR",
        "source_organism": {
            "taxId": "9874",
            "scientificName": "Odocoileus virginianus",
            "fullName": "Odocoileus virginianus (White-tailed deer)"
        },
        "name": "Epithelial cell adhesion molecule",
        "description": [
            "May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E"
        ],
        "length": 312,
        "sequence": "MPADFHLHSPGSQLLTQSLETGRGCVCESYKLTTNCSVNAYGQCQCISAGTQHSIICTKLAAKCLVMKAEMSHSKTGRRQKPEGAIQNNDGLYDPECDDKGLFKAKQCNGTSTCWCVNTAGVRRTDKDSEISCSEPVRTYWIIIELKHKTREKPYDLQSLQSALKEVIISRYQLDPKYITNILYENDIITIDLVQNSSQKTQNDVDIADVAYYFEKDVKDESLFHSKRMDLKVNGELLDLDPSRTSIYYVDEKPPEFSMQGLQAGIIAVIVVVVVAIIAGIIVLVVSRKKRMAKYEKAEIKEMGEMHRELNA",
        "proteome": "UP001652640",
        "gene": "EPCAM",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b091de9e6395f489216cecd3ee2fc8b796653784",
        "counters": {
            "domain_architectures": 1039,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1039
        }
    }
}