General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J0TY99",
        "id": "A0A6J0TY99_9SAUR",
        "source_organism": {
            "taxId": "103695",
            "scientificName": "Pogona vitticeps",
            "fullName": "Pogona vitticeps (central bearded dragon)"
        },
        "name": "Kelch domain-containing protein 8B",
        "description": [
            "Involved in pinching off the separated nuclei at the cleavage furrow and in cytokinesis. Required for mitotic integrity and maintenance of chromosomal stability. Protects cells against mitotic errors, centrosomal amplification, micronucleus formation and aneuploidy. Plays a key role of midbody function involving abscission of the daughter cells during cytokinesis and appropriate chromosomal and nuclear segregation into the daughter cells"
        ],
        "length": 354,
        "sequence": "MEAANAKSFYWEVFPPMPACRVYCSPAYQDGHLYVVGGCSQQGLPVDTVEMLDIVSHKWTGLPPMPTPRAGAATVMLDKEVLVIGGVDSTQSPLASVEAYHVDEGKWEKKADLAQASMGVSAVEKDGNVYALGGMGADTSPQALVQMYEPTKDCWLALPSMPTPCYGASTFLHGNKIYVMGGRQGKLPVTAFEAFDLEVRSWTRYPSVPSRRAFASCAMAEGCFFSLGGLQQPGPHNFYSRPHFVNTVEMFDTEEGSWSRLSRTIRMRDKRADFVAGYLGGRVVAAGGLGNQSCPLGSVEGFNLARKKWDALPSMPTGRCSCSSLEAANLLFVIGGVAQGPSSAVEALCLQEGV",
        "proteome": "UP001652642",
        "gene": "KLHDC8B",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "81c8182a0a3c86be0ced0d245c622f2a6f979d0e",
        "counters": {
            "domain_architectures": 1972,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1972
        }
    }
}