GET /api/protein/UniProt/A0A6J0J7X5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J0J7X5",
"id": "A0A6J0J7X5_9PASS",
"source_organism": {
"taxId": "321398",
"scientificName": "Lepidothrix coronata",
"fullName": "Lepidothrix coronata (blue-crowned manakin)"
},
"name": "Protein boule-like",
"description": [
"Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation"
],
"length": 317,
"sequence": "MDPEGAVTDQMQTESLPPCPNTVSPVRLNNLISSPRFGTVTPNRVFVGGIDFKTNENDLKTFFAQYGSVREVKIINDRAGVSKGYGFVTFETQEEAQKILQDAKKLNYKDKKLNIGPAIRKQQLRSPNARSAVTPQAGTMYTTTAVSPEAGTMYLTTSSGYPYVYHNGVAYFHTSEVSPVQQPWPSRSVSSSPVMVAPPVYQSPTYHYQAPTQCFSSQWQWSVLQSPTSSPPLLYLQPSEVFYQPIGITQEGGCISPPLLMEAAVPEQLYSDHGVQTLHHQPYAQSHIAMPAAELKSRSVRRHFSHPSSVSLKPQYA",
"proteome": "UP000504624",
"gene": "BOLL",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0eb7dadcabd2c02a94f505008bf374cf6371f960",
"counters": {
"domain_architectures": 222038,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 222038
}
}
}