HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J0GWC7",
"id": "A0A6J0GWC7_9PASS",
"source_organism": {
"taxId": "321398",
"scientificName": "Lepidothrix coronata",
"fullName": "Lepidothrix coronata (blue-crowned manakin)"
},
"name": "Tumor protein 63 (p63)",
"description": [
"Acts as a sequence specific DNA binding transcriptional activator or repressor. The isoforms contain a varying set of transactivation and auto-regulating transactivation inhibiting domains thus showing an isoform specific activity. May be required in conjunction with TP73/p73 for initiation of p53/TP53 dependent apoptosis in response to genotoxic insults and the presence of activated oncogenes"
],
"length": 680,
"sequence": "MNFEPAPFTTLQYYPDTCIQRFVETPSPFSWKESYYRSAMSQGSQPREFLSPEVIQHLWDFLEQPICSVQPIDLNFIDGPSENGSTNKIEISMDCVRVQDTELNDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTEHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPXPPAPWLIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSMQSQSSYGSNSPPLSKMNSMNKLPSVSQLINPQQRNALTPTTIPDSMGTNIPMMGTHMAMTGDMNGLSPTQALPPPLSMPSMSHCTPPPPYPSDCSIVSFLARLGCSSCVDYFTTQGLTTIYQIEHYSMDDLVSLKIPEQFRHAIWKGILDHRQLHDFSSPPHLLRTPSGASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE",
"proteome": "UP000504624",
"gene": "TP63",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0000976",
"name": "transcription cis-regulatory region binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051262",
"name": "protein tetramerization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006915",
"name": "apoptotic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "971a6e93f680f44c0f4c7c1131009890cae28dcd",
"counters": {
"domain_architectures": 2261,
"entries": 25,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"pfam": 3,
"cdd": 2,
"smart": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2261
}
}
}