GET /api/protein/UniProt/A0A6J0GGR1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J0GGR1",
"id": "A0A6J0GGR1_9PASS",
"source_organism": {
"taxId": "321398",
"scientificName": "Lepidothrix coronata",
"fullName": "Lepidothrix coronata (blue-crowned manakin)"
},
"name": "BTB domain-containing protein",
"description": [
"Auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization"
],
"length": 434,
"sequence": "MALKEAGGSILPISDMVSGPSGSPFPEVVELNVGGQVYVTRHSTLLSVPDSTLATMFSPCRGGPAAARQLPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLGDLVKLLSPKVTKQSSLNDEGCQSDLEDSNSQGSSDRLQRAALDKRSGFLTVGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGETLNESRDPDRPPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSTGTAAFINQYRDDKIWSSYTEYIFFRPPQRTVSPKQDHEERKHDKVLDKGSESGTSCNELSTSSCDSHSEASTPQENATSTQPSTAHQPNTLTLDRPSKKAPVQWMPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMRKCIQDFKKIHIPDYFPERKRPWQSELLQKYGL",
"proteome": "UP000504624",
"gene": "KCTD8",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051260",
"name": "protein homooligomerization",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2231b383d0e2bf7198f7bd33f04c55126c47242b",
"counters": {
"domain_architectures": 3358,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 2,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3358
}
}
}