GET /api/protein/UniProt/A0A6J0C3F8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J0C3F8",
        "id": "A0A6J0C3F8_NEOLC",
        "source_organism": {
            "taxId": "441921",
            "scientificName": "Neodiprion lecontei",
            "fullName": "Neodiprion lecontei (Redheaded pine sawfly)"
        },
        "name": "GMP reductase",
        "description": [
            "Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides"
        ],
        "length": 348,
        "sequence": "MPNIINDIKLDFKDVLLRPKRSTLKSRSDVDLYREMKFRNSKRTYKGIPVMASNMDTIGTFEMAKALSQHGIFTTVHKYYTAEEWKDFAARNPGCINNIAVSSGTGQEDFERLSSIVNSVPEISFICLDVANGYSQHFVEFVRKVRFAYPNHTIIAGNVVTGEMVEELILSGADVIKVGIGPGSVCTTRMKTGVGYPQLSAVIECADAAHGLNGHIISDGGCTCPGDLAKAFGAGADFVMAGGMFAGHDQCGGETIEKEGKRFKLFYGMASSTAMQKHAGGVAEYRSSEGKTVEIPYRGDVEKTVLDILGGLRSACTYTGAARLQELPRRATFIRCTQQLNTVYGPPN",
        "proteome": "UP000829291",
        "gene": "LOC107225201",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003920",
                "name": "GMP reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009117",
                "name": "nucleotide metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1902560",
                "name": "GMP reductase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a2d25702dedbe8e7de1a6960dc2307b5a08c8f60",
        "counters": {
            "domain_architectures": 17457,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17457
        }
    }
}