General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J0AWN3",
        "id": "A0A6J0AWN3_VICPA",
        "source_organism": {
            "taxId": "30538",
            "scientificName": "Vicugna pacos",
            "fullName": "Vicugna pacos (Alpaca)"
        },
        "name": "Distal membrane-arm assembly complex protein 2",
        "description": [
            "Required for the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Involved in the assembly of the distal region of complex I"
        ],
        "length": 258,
        "sequence": "MVAPRTSLRLVAPVWNRGAGSIRGLSRAVDPEGSQRKERTLFQFLADRFYDVAALREYMLQKQVLKVHQKNRSFTYIKERYGPYVAGAHFILKQGGAVKFQDKEWMRSSGRGLSSLEFWEFRAVPIEAVDASGCAINYQGLDHLLALKELQSLSLRCCPHVDDWCLSRLHPLADSLQELSLAGCPRISERGLACLHHLRNLRRLDISHLPAVSNPGLTQILVEEMLPNCEVLGAGWAQGLKLGLEEQSQDTASSPIPA",
        "proteome": "UP001652581",
        "gene": "DMAC2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}