GET /api/protein/UniProt/A0A6J0A3P9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J0A3P9",
        "id": "A0A6J0A3P9_ACIJB",
        "source_organism": {
            "taxId": "32536",
            "scientificName": "Acinonyx jubatus",
            "fullName": "Acinonyx jubatus (Cheetah)"
        },
        "name": "Homeobox-containing protein 1",
        "description": [
            "Binds directly to 5'-TTAGGG-3' repeats in telomeric DNA. Associates with the telomerase complex at sites of active telomere processing and positively regulates telomere elongation. Important for TERT binding to chromatin, indicating a role in recruitment of the telomerase complex to telomeres. Also plays a role in the alternative lengthening of telomeres (ALT) pathway in telomerase-negative cells where it promotes formation and/or maintenance of ALT-associated promyelocytic leukemia bodies (APBs). Enhances formation of telomere C-circles in ALT cells, suggesting a possible role in telomere recombination. Might also be involved in the DNA damage response at telomeres"
        ],
        "length": 420,
        "sequence": "MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD",
        "proteome": "UP001652583",
        "gene": "HMBOX1",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003691",
                "name": "double-stranded telomeric DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045893",
                "name": "positive regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "189565d56be6cb077c096c83fd16513ead95b2a7",
        "counters": {
            "domain_architectures": 2311,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 3,
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 2,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2311
        }
    }
}