GET /api/protein/UniProt/A0A6I9ZX25/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I9ZX25",
"id": "A0A6I9ZX25_ACIJB",
"source_organism": {
"taxId": "32536",
"scientificName": "Acinonyx jubatus",
"fullName": "Acinonyx jubatus (Cheetah)"
},
"name": "LanC-like protein 2",
"description": [
"Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes"
],
"length": 454,
"sequence": "MGETMSKRLKFHLGGEAEMEERAFTNPFPDYEAAASAVFAAGAAEDTGCARPQPTTDELGLPFHNDGKIIHNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQKTIVCRDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILVPETSRFPAFELAPSQRDKKMQ",
"proteome": "UP001652583",
"gene": "LANCL2",
"go_terms": [
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0031179",
"name": "peptide modification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a637eedecf8cd348ef6d75ddfc7e0fd81374d56d",
"counters": {
"domain_architectures": 10612,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prints": 2,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10612
}
}
}