GET /api/protein/UniProt/A0A6I9ZIK8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I9ZIK8",
        "id": "A0A6I9ZIK8_ACIJB",
        "source_organism": {
            "taxId": "32536",
            "scientificName": "Acinonyx jubatus",
            "fullName": "Acinonyx jubatus (Cheetah)"
        },
        "name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2",
        "description": [
            "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 99,
        "sequence": "MAAAVASRGIRAKLGLREIRVHLCQRSPGSQGVREFIEKHYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRAIENVLSGKA",
        "proteome": "UP001652583",
        "gene": "NDUFA2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "852f0a5d90ec90df505ecc00a82e4bf1b3023bd6",
        "counters": {
            "domain_architectures": 10106,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10106
        }
    }
}