GET /api/protein/UniProt/A0A6I9YB53/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I9YB53",
        "id": "A0A6I9YB53_9SAUR",
        "source_organism": {
            "taxId": "35019",
            "scientificName": "Thamnophis sirtalis",
            "fullName": "Thamnophis sirtalis"
        },
        "name": "Mitochondrial import inner membrane translocase subunit Tim21",
        "description": [
            "Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane"
        ],
        "length": 242,
        "sequence": "MLSIFVRGICCSDQLLRSALKQALARHRTAFLKTWAWSRVGQGLSHDHVLSPEVGYDVIKRSLWVLPAGLRSEKSENRSTQLPVQRRKGDVSPSAAQKVKEAGRDFTYLIVVIIGIGVTGGLFYVIFKELFSSSSPSKIYGDALEKCRAHPEVIGIFGEPIKGYGEATRRGRRQLVSHIEFVKDGLKYMRLKFYIEGSEKGKQGTVHLEVKENPESGKYEYRYIFVDIDSYPRRMIIVEDNR",
        "proteome": "UP000504617",
        "gene": "TIMM21",
        "go_terms": [
            {
                "identifier": "GO:0030150",
                "name": "protein import into mitochondrial matrix",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005744",
                "name": "TIM23 mitochondrial import inner membrane translocase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "725247455a3d42ee2daa6346a53a13a92c0f7436",
        "counters": {
            "domain_architectures": 4032,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4032
        }
    }
}