GET /api/protein/UniProt/A0A6I9XMJ6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I9XMJ6",
"id": "A0A6I9XMJ6_9HYME",
"source_organism": {
"taxId": "144034",
"scientificName": "Pogonomyrmex barbatus",
"fullName": "Pogonomyrmex barbatus (red harvester ant)"
},
"name": "Defective in cullin neddylation protein",
"description": [
"Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity",
"Promotes neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes and thus regulates SCF-type complex activity. Function promotes cell proliferation"
],
"length": 254,
"sequence": "MHKLKFSQRDKVKKFITFTQTGEQTAIYCLAQNDWKLDLASDNYFQNPEAYYKEPKNSVDKKKLEILYSKYQDPSEPNKITADGIMKFLDDLSLSPESKLVLIIAWKFRAETQCEFTKEEFMTGMMDLGVDSIDKLKARLHSLENDLRDPLKFKDFYHFTFNYAKNAGQKGLDLDMAIAYWNIVLDDKFKFLQLWCDFLQEHHKRSIPKDTWNLLLDFALMINSDMSNYDEEGAWPVLIDDFVEWAQPQVRQSL",
"proteome": "UP000504615",
"gene": "LOC105433556",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4414098205856731229e552966bfe53ce7823985",
"counters": {
"domain_architectures": 4686,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 1,
"pfam": 2,
"profile": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4686
}
}
}