GET /api/protein/UniProt/A0A6I9XMJ6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I9XMJ6",
        "id": "A0A6I9XMJ6_9HYME",
        "source_organism": {
            "taxId": "144034",
            "scientificName": "Pogonomyrmex barbatus",
            "fullName": "Pogonomyrmex barbatus (red harvester ant)"
        },
        "name": "Defective in cullin neddylation protein",
        "description": [
            "Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity",
            "Promotes neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes and thus regulates SCF-type complex activity. Function promotes cell proliferation"
        ],
        "length": 254,
        "sequence": "MHKLKFSQRDKVKKFITFTQTGEQTAIYCLAQNDWKLDLASDNYFQNPEAYYKEPKNSVDKKKLEILYSKYQDPSEPNKITADGIMKFLDDLSLSPESKLVLIIAWKFRAETQCEFTKEEFMTGMMDLGVDSIDKLKARLHSLENDLRDPLKFKDFYHFTFNYAKNAGQKGLDLDMAIAYWNIVLDDKFKFLQLWCDFLQEHHKRSIPKDTWNLLLDFALMINSDMSNYDEEGAWPVLIDDFVEWAQPQVRQSL",
        "proteome": "UP000504615",
        "gene": "LOC105433556",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4414098205856731229e552966bfe53ce7823985",
        "counters": {
            "domain_architectures": 4686,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 1,
                "pfam": 2,
                "profile": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4686
        }
    }
}