General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I9PAD2",
        "id": "A0A6I9PAD2_9TELE",
        "source_organism": {
            "taxId": "8208",
            "scientificName": "Notothenia coriiceps",
            "fullName": "Notothenia coriiceps (black rockcod)"
        },
        "name": "Cyclin-A2",
        "description": [
            "Essential for the control of the cell cycle at the G2/M (mitosis) transition"
        ],
        "length": 434,
        "sequence": "MSGVSRERSAATSALHNQENVLSRLRGSIKPRAAANENQENLAPKQGAAGSRTVLGALQNNLRIKAQNQCEKQESSQSLSCKNEDLVRNCSEKPVAKPPIFQIHVDEPDGACIKKPQPVVKAKASAEATSLAISAVARLRQPLATLDIPSSMDVSFDSPMDMSVVEGEEKLLDVNDVPEYAAEIHTYLREMEIKTRPKAGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLSFDLAAPTIIQFLSQYFLNKSVSKQVQSLAMYLGELSLVDSDPFLKYIPSHTAAAAYTLANHTVTGGSWPKSLTEMSGYSLEDLMPCVEDLHQIYLNAAQHAQQSVREKYKGPKYSEVSLIDAPSKLLLN",
        "proteome": "UP000504611",
        "gene": "ccna2",
        "go_terms": [
            {
                "identifier": "GO:0016538",
                "name": "cyclin-dependent protein serine/threonine kinase regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0044772",
                "name": "mitotic cell cycle phase transition",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f0895ef7fd66a7143cfb9607b416fcedd7ae1cfb",
        "counters": {
            "domain_architectures": 1328,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "pfam": 3,
                "cathgene3d": 1,
                "smart": 2,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1328
        }
    }
}