GET /api/protein/UniProt/A0A6I9M9U7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I9M9U7",
"id": "A0A6I9M9U7_PERMB",
"source_organism": {
"taxId": "230844",
"scientificName": "Peromyscus maniculatus bairdii",
"fullName": "Peromyscus maniculatus bairdii (Prairie deer mouse)"
},
"name": "Thymosin beta",
"description": [
"Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization"
],
"length": 45,
"sequence": "MSDKPDLSEVERFDRSKLKKTNTEEKNTLPSKETIQQEKEYIKRS",
"proteome": "UP000694547",
"gene": "LOC102903304",
"go_terms": [
{
"identifier": "GO:0003785",
"name": "actin monomer binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007015",
"name": "actin filament organization",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c96314aa692f4b40c814b6411bf0116e09c235c6",
"counters": {
"domain_architectures": 2401,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2401
}
}
}