HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I9IUR6",
"id": "A0A6I9IUR6_VICPA",
"source_organism": {
"taxId": "30538",
"scientificName": "Vicugna pacos",
"fullName": "Vicugna pacos (Alpaca)"
},
"name": "Melanoma antigen preferentially expressed in tumors isoform X1",
"description": null,
"length": 513,
"sequence": "MWPKLPQRIYFQDSFRSRFFRMGVQTPLRLLELAGQSLLRDEALAIAALEELPTELFPPLFTVAFAGRHSEMLKAMVQAWPFPCLPLGSLMREHQPHLDTFQAAIDGLDVLLTQEVRPRRWKLQVLDLRRNAHQDFWAMWSSSRASLCSLLEPEAAPPMRKRRRVEVSRAGPKQPPVPVEVLIDLCLKEGTPDQSLTYLLKKVKQRGGSLRLCCQKLKIFAMPMQTIQKMLKMVQLDSVQDLEVNCTWKLATLGRFAPYLGQMVNLRRLLLSHIHMAPHAAPGEEEHCVSQLTAQFLSLHHLQELYLDSISFLEGRLDQVLRCLKNPLETLSITNCLISESDLMHLSQSPSITQLKDLGLSGVSLTNVSSEPLQVLIERTSATLQDLDLDECGIMDAQFSAILPALSRCSQLMTFSFCGNPISMAVLESLLCHTVGLSKLSHVLYPAPLESYEDVGGTLHLGRLAQLHARLKQMLRESGRPSMVWFSANPCPHCGDRTFYDPDPILCPCYMPD",
"proteome": "UP001652581",
"gene": "PRAME",
"go_terms": [
{
"identifier": "GO:0008284",
"name": "positive regulation of cell population proliferation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043066",
"name": "negative regulation of apoptotic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045596",
"name": "negative regulation of cell differentiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045892",
"name": "negative regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "290852af13cf4f8f8929b07f8465a2dee1ecfc3b",
"counters": {
"domain_architectures": 3276,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pirsf": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3276
}
}
}