GET /api/protein/UniProt/A0A6I9IN13/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I9IN13",
"id": "A0A6I9IN13_VICPA",
"source_organism": {
"taxId": "30538",
"scientificName": "Vicugna pacos",
"fullName": "Vicugna pacos (Alpaca)"
},
"name": "Palmitoyl-protein thioesterase ABHD10, mitochondrial",
"description": [
"Acts as an acyl-protein thioesterase that hydrolyzes fatty acids from acylated residues in proteins. Regulates the mitochondrial S-depalmitoylation of the nucleophilic active site residue of peroxiredoxin-5/PRDX5, a key antioxidant protein, therefore modulating mitochondrial antioxidant ability. Also catalyzes the deglucuronidation of mycophenolic acid acyl-glucuronide, an active metabolite of the immunosuppressant drug mycophenolate"
],
"length": 354,
"sequence": "MCALWVVKIVQPLFTKFRLPAGGACAALVPERSARFRRSARGERTAGKMARLGKAAVAAWERYRRWGWPAVSFGVHRGLGALLARKPERAPWWLPACRQKSSVSFLSRPDLPNLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFCKSLGHACIRFDYSGLGNSDGNLEECTVGKWRKDVLSVIDELAVGPQILVGSSLGGWLMLHAAIARPQKVVALIGIAAAVDSLVTQFNQLPIETKKEIEMKGVWSMPSKYSEEGVYRVQYSVVKEAEHHCLLHSPIPVSCPVRLLHGMKDDIIPWQTSVQVADRIVSTDVDVILRKHSDHRMKEKADLQLLVYTIDDLIDKLSTVVN",
"proteome": "UP001652581",
"gene": "ABHD10",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
"counters": {
"domain_architectures": 305779,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 305779
}
}
}