General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I9IN13",
        "id": "A0A6I9IN13_VICPA",
        "source_organism": {
            "taxId": "30538",
            "scientificName": "Vicugna pacos",
            "fullName": "Vicugna pacos (Alpaca)"
        },
        "name": "Palmitoyl-protein thioesterase ABHD10, mitochondrial",
        "description": [
            "Acts as an acyl-protein thioesterase that hydrolyzes fatty acids from acylated residues in proteins. Regulates the mitochondrial S-depalmitoylation of the nucleophilic active site residue of peroxiredoxin-5/PRDX5, a key antioxidant protein, therefore modulating mitochondrial antioxidant ability. Also catalyzes the deglucuronidation of mycophenolic acid acyl-glucuronide, an active metabolite of the immunosuppressant drug mycophenolate"
        ],
        "length": 354,
        "sequence": "MCALWVVKIVQPLFTKFRLPAGGACAALVPERSARFRRSARGERTAGKMARLGKAAVAAWERYRRWGWPAVSFGVHRGLGALLARKPERAPWWLPACRQKSSVSFLSRPDLPNLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFCKSLGHACIRFDYSGLGNSDGNLEECTVGKWRKDVLSVIDELAVGPQILVGSSLGGWLMLHAAIARPQKVVALIGIAAAVDSLVTQFNQLPIETKKEIEMKGVWSMPSKYSEEGVYRVQYSVVKEAEHHCLLHSPIPVSCPVRLLHGMKDDIIPWQTSVQVADRIVSTDVDVILRKHSDHRMKEKADLQLLVYTIDDLIDKLSTVVN",
        "proteome": "UP001652581",
        "gene": "ABHD10",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
        "counters": {
            "domain_architectures": 305779,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 305779
        }
    }
}