HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I8S780",
"id": "A0A6I8S780_XENTR",
"source_organism": {
"taxId": "8364",
"scientificName": "Xenopus tropicalis",
"fullName": "Xenopus tropicalis (Western clawed frog)"
},
"name": "RNA-binding protein FUS",
"description": [
"DNA/RNA-binding protein that plays a role in various cellular processes such as transcription regulation, RNA splicing, RNA transport, DNA repair and damage response. Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3'. Binds to nascent pre-mRNAs and acts as a molecular mediator between RNA polymerase II and U1 small nuclear ribonucleoprotein thereby coupling transcription and splicing. Also binds its own pre-mRNA and autoregulates its expression; this autoregulation mechanism is mediated by non-sense-mediated decay. Plays a role in DNA repair mechanisms by promoting D-loop formation and homologous recombination during DNA double-strand break repair. In neuronal cells, plays crucial roles in dendritic spine formation and stability, RNA transport, mRNA stability and synaptic homeostasis"
],
"length": 462,
"sequence": "MATNDYSQQASQGYGAYPSQPSQGYGQQGSQSYSQQGYSGYGQSAGGSSYGQSGYSSSYGQDQSAGYSSQSTPQGYGSGGYGNSQSSQSPYGSGQPQQQSQSSYSSYSQQPPASSNTGSGSSQPSSYQQQQSGGYGQQPSGGYGSQQSSYGGQQQSSYGSQQGQSGYGSQQPSSYGQQQQSSYSQPQGYGQQQTQYSGGGPREGGGPPRHEMAEQDNSDNNTIFVQGLGENVTVESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNSRGGGNGRGRGRGGGPMGRGGFGGPPGGSGSRGGSGGYPSGGGGQQRAGDWKCPNPSCENMNFSWRNECNQCKAPKPEGPGGPGGSHMGGGGFGDERRGGRGGFDRGGFRGRGGDRGGFRGGRGGDRGGFGPGKMDSRGDHRQDRRDRPY",
"proteome": null,
"gene": "fus",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0409d8b8fa12093915368c8e3117a3a24b0f71c7",
"counters": {
"domain_architectures": 3435,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cdd": 1,
"cathgene3d": 2,
"profile": 2,
"smart": 2,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3435
}
}
}