General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8R480",
        "id": "A0A6I8R480_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Antizyme inhibitor 2",
        "description": [
            "Catalyzes the first and rate-limiting step of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine. Polyamines are essential for cell proliferation and are implicated in cellular processes, ranging from DNA replication to apoptosis"
        ],
        "length": 453,
        "sequence": "MERNLHCNACHLQERDRDRTMDISELHTCTFLAGMNMTILDKGMSVQQFVKQKSISNSASGNEDAFYVADLGDIIKKYWQFSKGLPRVKPFYAMKCNSTRAVLQMLAFLGTGFACCSMAELDMVLRMGVPAADIVFVNPCKQVSHIRYAAEYGVRKMTFDCESELLKLAASYPQAEMILQIVTDNKEPWHTLSGICGVYISECENLLKKAKSLNMDVFGVSFHTGSRCKDTHSFHKAIEDARKVFDIGKNLGHQMRLLDIGGGFPGDSESRPTFEKFAEVIRISLDQSFPCNEDVQIIAEPGRFYVTSAFTAALNIVTKKVVTKKDGEERRQFSYVLNDGIFGSFFLNYMQMEETWPVVGKDFDTAQELFPSILWGPTCASEDKIVKDIDLPELEMGDWIIFPNMGAYSMSMTSNFNAFSTPKIYFVFTRKMWTVGQILKKEKLLQNHPQNNL",
        "proteome": "UP000008143",
        "gene": "LOC100498594",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006596",
                "name": "polyamine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "46a7e5124b5b34b3c3ae43eae761296808eab718",
        "counters": {
            "domain_architectures": 19125,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 2,
                "ssf": 2,
                "panther": 1,
                "prosite": 1,
                "prints": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19125
        }
    }
}