GET /api/protein/UniProt/A0A6I8QQN1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I8QQN1",
"id": "A0A6I8QQN1_XENTR",
"source_organism": {
"taxId": "8364",
"scientificName": "Xenopus tropicalis",
"fullName": "Xenopus tropicalis (Western clawed frog)"
},
"name": "Polyprenol dehydrogenase",
"description": [
"Oxidoreductase that plays a key role in early steps of protein N-linked glycosylation by mediating two non-consecutive steps in dolichol biosynthesis. Acts both as a NAD(+)-dependent dehydrogenase and as a NADPH-dependent reductase during the conversion of polyprenol into dolichol. First catalyzes the NAD(+)-dependent dehydrogenation of polyprenol into polyprenal; polyprenal is then reduced into dolichal by SRD5A3. It then catalyzes the NADPH-dependent reduction of dolichal into dolichol. May also acts as a positive regulator of starvation-induced autophagy"
],
"length": 327,
"sequence": "MWLRAVLLPILRVYYTGLTVILQQVCGRRAFSLPVIPSQNGKVAIVTGGAKGIGYSTAKHLSSLGMHVIIAGNNEAEGSEAVTRIQQDTHNEKVEFLYCDLASMKSIRQFVQIFKAKNLCLHVLVNNAGVMLVPERKTADGFEEHFGLNYLGHFLLTNLLLKTTKESGTENLNARIITVSSATHYVGELNFDDLNSSCCYSPHGAYAQSKLALVMFTYYLQRQLSEDGCYVTANVVDPGVVNTDLYRNVCWPGRLVKWMAARLFFKTAEEGAATSIYASVAPELEGIGGCYLYNGQKTKSADISYNEDLQRKLWNESCKMVGIPGSA",
"proteome": "UP000008143",
"gene": "dhrsx",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a0c95b509a3fe852564663f48768d986938c9d65",
"counters": {
"domain_architectures": 599639,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 2,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 599639
}
}
}