GET /api/protein/UniProt/A0A6I8QQN1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8QQN1",
        "id": "A0A6I8QQN1_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Polyprenol dehydrogenase",
        "description": [
            "Oxidoreductase that plays a key role in early steps of protein N-linked glycosylation by mediating two non-consecutive steps in dolichol biosynthesis. Acts both as a NAD(+)-dependent dehydrogenase and as a NADPH-dependent reductase during the conversion of polyprenol into dolichol. First catalyzes the NAD(+)-dependent dehydrogenation of polyprenol into polyprenal; polyprenal is then reduced into dolichal by SRD5A3. It then catalyzes the NADPH-dependent reduction of dolichal into dolichol. May also acts as a positive regulator of starvation-induced autophagy"
        ],
        "length": 327,
        "sequence": "MWLRAVLLPILRVYYTGLTVILQQVCGRRAFSLPVIPSQNGKVAIVTGGAKGIGYSTAKHLSSLGMHVIIAGNNEAEGSEAVTRIQQDTHNEKVEFLYCDLASMKSIRQFVQIFKAKNLCLHVLVNNAGVMLVPERKTADGFEEHFGLNYLGHFLLTNLLLKTTKESGTENLNARIITVSSATHYVGELNFDDLNSSCCYSPHGAYAQSKLALVMFTYYLQRQLSEDGCYVTANVVDPGVVNTDLYRNVCWPGRLVKWMAARLFFKTAEEGAATSIYASVAPELEGIGGCYLYNGQKTKSADISYNEDLQRKLWNESCKMVGIPGSA",
        "proteome": "UP000008143",
        "gene": "dhrsx",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a0c95b509a3fe852564663f48768d986938c9d65",
        "counters": {
            "domain_architectures": 599639,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 599639
        }
    }
}