GET /api/protein/UniProt/A0A6I8Q8A1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I8Q8A1",
"id": "A0A6I8Q8A1_XENTR",
"source_organism": {
"taxId": "8364",
"scientificName": "Xenopus tropicalis",
"fullName": "Xenopus tropicalis (Western clawed frog)"
},
"name": "Transthyretin",
"description": [
"Thyroid hormone-binding protein, with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain",
"Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain"
],
"length": 149,
"sequence": "LFFIKSYILHLCLFSSISQGHVSHGEADSKCPLMVKVLDAVRGIPAANLLVQVFRNTEGNWELISSGKTTELGEIHNIITDEQFTEGVYKIEFATKTFWRKLGLSPFHEYVDVVFSANDAGHRHYTIAVLLTPYSISSTAVVSEPHDDL",
"proteome": null,
"gene": "ttr",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "37cfea698395c831834d0ac5e8c93d9dfd4537a4",
"counters": {
"domain_architectures": 15261,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15261
}
}
}