General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8Q8A1",
        "id": "A0A6I8Q8A1_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Transthyretin",
        "description": [
            "Thyroid hormone-binding protein, with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain",
            "Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain"
        ],
        "length": 149,
        "sequence": "LFFIKSYILHLCLFSSISQGHVSHGEADSKCPLMVKVLDAVRGIPAANLLVQVFRNTEGNWELISSGKTTELGEIHNIITDEQFTEGVYKIEFATKTFWRKLGLSPFHEYVDVVFSANDAGHRHYTIAVLLTPYSISSTAVVSEPHDDL",
        "proteome": null,
        "gene": "ttr",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "37cfea698395c831834d0ac5e8c93d9dfd4537a4",
        "counters": {
            "domain_architectures": 15261,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15261
        }
    }
}