GET /api/protein/UniProt/A0A6I8PQW6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8PQW6",
        "id": "A0A6I8PQW6_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Fucolectin tachylectin-4 pentraxin-1 domain-containing protein",
        "description": [
            "Acts as a defensive agent. Recognizes blood group fucosylated oligosaccharides including A, B, H and Lewis B-type antigens. Does not recognize Lewis A antigen and has low affinity for monovalent haptens"
        ],
        "length": 322,
        "sequence": "MLTLHLSLCCLFFIRMKCIVVLLVGISMGWVHSCSPPLGVNLARLGDVKQSSTYRPEYNAATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTLCEVEVYGQEAKPDAVVNLAKSGRARQSSTYRPEYNAAAAIDGDKGTNIFQHPCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINSPVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTLCEVEVYGQEI",
        "proteome": null,
        "gene": "XB5830569 [provisional]",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2ead9f621891a468bf4e5ea1129ee668d886e375",
        "counters": {
            "domain_architectures": 1848,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1848
        }
    }
}