GET /api/protein/UniProt/A0A6I8PQW6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I8PQW6",
"id": "A0A6I8PQW6_XENTR",
"source_organism": {
"taxId": "8364",
"scientificName": "Xenopus tropicalis",
"fullName": "Xenopus tropicalis (Western clawed frog)"
},
"name": "Fucolectin tachylectin-4 pentraxin-1 domain-containing protein",
"description": [
"Acts as a defensive agent. Recognizes blood group fucosylated oligosaccharides including A, B, H and Lewis B-type antigens. Does not recognize Lewis A antigen and has low affinity for monovalent haptens"
],
"length": 322,
"sequence": "MLTLHLSLCCLFFIRMKCIVVLLVGISMGWVHSCSPPLGVNLARLGDVKQSSTYRPEYNAATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTLCEVEVYGQEAKPDAVVNLAKSGRARQSSTYRPEYNAAAAIDGDKGTNIFQHPCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINSPVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTLCEVEVYGQEI",
"proteome": null,
"gene": "XB5830569 [provisional]",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2ead9f621891a468bf4e5ea1129ee668d886e375",
"counters": {
"domain_architectures": 1848,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1848
}
}
}