GET /api/protein/UniProt/A0A6I8PNY4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8PNY4",
        "id": "A0A6I8PNY4_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "3-oxo-5-alpha-steroid 4-dehydrogenase",
        "description": [
            "Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology",
            "Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology"
        ],
        "length": 254,
        "sequence": "MQCNQDMDYYMSLCLAIISVLFLIRQFTYPAAYGKHVATGKKQNGFMVPAKYGWFIQELPSFLVPVVVILYRQQCNSLGCKMLSFMFCGHYFQRTFIYSAFTRGRPSPLRIVLMAVVFCTYNGFLQGHCLVYVAEYPKDWCMDLRFISGVLIFCLGMGINIHSDHILRRLRKPSEVAYKIPQGGMFNYVSGANFLGEIVEWFGYAIATWSLPGFAFAFFTLCCIGPRAYHHHKFYLQSFKDYPRKRKALIPFIF",
        "proteome": "UP000008143",
        "gene": "srd5a2",
        "go_terms": [
            {
                "identifier": "GO:0003865",
                "name": "3-oxo-5-alpha-steroid 4-dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008202",
                "name": "steroid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016627",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "249a07fa23f546641bf50c576f6f83b8fb8dadf3",
        "counters": {
            "domain_architectures": 12867,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12867
        }
    }
}