General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8PI33",
        "id": "A0A6I8PI33_ORNAN",
        "source_organism": {
            "taxId": "9258",
            "scientificName": "Ornithorhynchus anatinus",
            "fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
        },
        "name": "LHFPL tetraspan subfamily member 4 protein",
        "description": [
            "Plays a role in the regulation of inhibitory synapse formation and function by being involved in maintening gamma-aminobutyric acid receptors (GABAARs) clustering and their associated scaffold proteins at inhibitory synaptic sites. Acts in concert with NLGN2 to recruit or stabilize GABAARs"
        ],
        "length": 238,
        "sequence": "MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGLAGRELTCRGSFTDFSTIPSGAFQAAAFFVLLSMVLILGCITCFALFFFCNTATVYKICAWMQLLAALCLVLGCMIFPDGWDTEMVKEMCGEKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQNDLLHDDLKTESKGEPRPGLEWGGRRRRHGPCPSWGS",
        "proteome": "UP000002279",
        "gene": "LHFPL4",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "090b33f53424fef950fa9d75254fcf32226adb4f",
        "counters": {
            "domain_architectures": 8155,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8155
        }
    }
}