HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I8PD70",
"id": "A0A6I8PD70_ORNAN",
"source_organism": {
"taxId": "9258",
"scientificName": "Ornithorhynchus anatinus",
"fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
},
"name": "Lipase domain-containing protein",
"description": [
"Hydrolyzes specifically phosphatidic acid (PA) to produce 2-acyl lysophosphatidic acid (LPA; a potent bioactive lipid mediator) and fatty acid. Does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG)"
],
"length": 422,
"sequence": "MLRLYLLFILIPWTKSDAEEKCLELTDLNVSDAIAEIFNPSVDVKMLLYTREFRNCAEPLFQSNYTLNTRFTQVKKTVMIVHGYRGKGQKPQWLPSMVQLLLKADDINVIVVDWVRGATTLYYPHAVKNTKNVSEILAEYILKLKTQGVSLDNIHMIGLSLGAHICGFVGKRLNGSLGRISGLDPAGPQFTGKPPNERLYRTDAKFVDVIHTDADALGFRNPMGHIDFYPNGGSKQPGCPKTIFSGSSFFKCDHQRSVYLFLSSLEGKCNLTACPCSSQQAFRNGQCVNYEVFKPLPCPQLVYTFIVDIIIWSKPTGKGYFKIKLIDKNGEKEETKIKGDYVTLEKFKQIRLFAAFYRDFKDISKISLTYFQKGGSSCINKIYLLKVQSLTNPERPPLCRYDFILKENVETTLKLISCLKQK",
"proteome": "UP000002279",
"gene": "LIPI",
"go_terms": [
{
"identifier": "GO:0016298",
"name": "lipase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006629",
"name": "lipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0052689",
"name": "carboxylic ester hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4b27ea83a55bae860624d8852585749e0e54f3f6",
"counters": {
"domain_architectures": 16973,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 16973
}
}
}