GET /api/protein/UniProt/A0A6I8PD70/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8PD70",
        "id": "A0A6I8PD70_ORNAN",
        "source_organism": {
            "taxId": "9258",
            "scientificName": "Ornithorhynchus anatinus",
            "fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
        },
        "name": "Lipase domain-containing protein",
        "description": [
            "Hydrolyzes specifically phosphatidic acid (PA) to produce 2-acyl lysophosphatidic acid (LPA; a potent bioactive lipid mediator) and fatty acid. Does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG)"
        ],
        "length": 422,
        "sequence": "MLRLYLLFILIPWTKSDAEEKCLELTDLNVSDAIAEIFNPSVDVKMLLYTREFRNCAEPLFQSNYTLNTRFTQVKKTVMIVHGYRGKGQKPQWLPSMVQLLLKADDINVIVVDWVRGATTLYYPHAVKNTKNVSEILAEYILKLKTQGVSLDNIHMIGLSLGAHICGFVGKRLNGSLGRISGLDPAGPQFTGKPPNERLYRTDAKFVDVIHTDADALGFRNPMGHIDFYPNGGSKQPGCPKTIFSGSSFFKCDHQRSVYLFLSSLEGKCNLTACPCSSQQAFRNGQCVNYEVFKPLPCPQLVYTFIVDIIIWSKPTGKGYFKIKLIDKNGEKEETKIKGDYVTLEKFKQIRLFAAFYRDFKDISKISLTYFQKGGSSCINKIYLLKVQSLTNPERPPLCRYDFILKENVETTLKLISCLKQK",
        "proteome": "UP000002279",
        "gene": "LIPI",
        "go_terms": [
            {
                "identifier": "GO:0016298",
                "name": "lipase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0052689",
                "name": "carboxylic ester hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4b27ea83a55bae860624d8852585749e0e54f3f6",
        "counters": {
            "domain_architectures": 16973,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16973
        }
    }
}