General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8P5A6",
        "id": "A0A6I8P5A6_ORNAN",
        "source_organism": {
            "taxId": "9258",
            "scientificName": "Ornithorhynchus anatinus",
            "fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
        },
        "name": "Protein FAM162A",
        "description": [
            "Proposed to be involved in regulation of apoptosis; the exact mechanism may differ between cell types/tissues. May be involved in hypoxia-induced cell death of transformed cells implicating cytochrome C release and caspase activation (such as CASP9) and inducing mitochondrial permeability transition. May be involved in hypoxia-induced cell death of neuronal cells probably by promoting release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus; however, the involvement of caspases has been reported conflictingly"
        ],
        "length": 148,
        "sequence": "LARRTCGCHPRDGEGSGAAGGGLGSSRPGGAPRERGAGSSRPPSVPLRNVQGAAPQATSWEKKVLVWSGRFKKEDEIPEAITFEMLDAAKNKFRVKISYAMMALTVMGCVLMIIKGKQAARRHESLTSMNLEKKARLREEAAALQDHK",
        "proteome": "UP000002279",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1b48ad22e090a49f381d6b6a795f3eaeacb3a5ba",
        "counters": {
            "domain_architectures": 2437,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2437
        }
    }
}