GET /api/protein/UniProt/A0A6I8NRP6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8NRP6",
        "id": "A0A6I8NRP6_ORNAN",
        "source_organism": {
            "taxId": "9258",
            "scientificName": "Ornithorhynchus anatinus",
            "fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
        },
        "name": "Beta-2-glycoprotein 1",
        "description": [
            "Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells"
        ],
        "length": 296,
        "sequence": "MLNCKPSTMVPKVLFLFGSFLCHLAFAGRICPKPQEVPFATVEPLKAFYEPGDVIVYTCKAGYSMLGQVRKYTCPLTGLWPVNTVKCLPITCPPPTTPNFAKVSYYKPSATNDSIYKDEVVFECLPPYAMFGNATIRCTEHGNWTELPECRDVKCPFPTRPDNGYVNYPKKVALGYKDKATYGCHSTYTLDGPETVECGKTGTWSAQPTCKASCKVSVKKATVLYKGNRVKIQEQFKNGMSHGEHVAFFCKNKEKKCSYTVEAQCVDGIFKVPDCFKEHSSLAFWKTDAWDVPLCS",
        "proteome": "UP000002279",
        "gene": "APOH",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f96a11651fbc246917a5c05c322253d2ab7abd64",
        "counters": {
            "domain_architectures": 274,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 2,
                "cdd": 1,
                "smart": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 274
        }
    }
}