GET /api/protein/UniProt/A0A6I8N9L5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8N9L5",
        "id": "A0A6I8N9L5_ORNAN",
        "source_organism": {
            "taxId": "9258",
            "scientificName": "Ornithorhynchus anatinus",
            "fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
        },
        "name": "Pro-neuregulin-4, membrane-bound isoform",
        "description": [
            "Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors"
        ],
        "length": 205,
        "sequence": "MRYEMQTTAVSFHSVQELWKYCITTICLFLFDFKYRTFEVLFFNGSLPPEIKHQNKMPTDHEEPCGFSHRSFCLNGGICYVIPTVPSPFCRCIENYTGARCEEVFLPSTNIQTKSELFATFLALAILLGVLTIGAVYFLCRKGHLQRANSTQYGVGLVETGSSSAYNNSDEDLVFQEDKTFSPVRSHSSLQDLNVQDRVSFRISI",
        "proteome": "UP000002279",
        "gene": "NRG4",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}