HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I8M9P3",
"id": "A0A6I8M9P3_9CORY",
"source_organism": {
"taxId": "2719119",
"scientificName": "Corynebacterium rouxii",
"fullName": "Corynebacterium rouxii"
},
"name": "Lipid II isoglutaminyl synthase (glutamine-hydrolyzing) subunit MurT",
"description": [
"The lipid II isoglutaminyl synthase complex catalyzes the formation of alpha-D-isoglutamine in the cell wall lipid II stem peptide. The MurT subunit catalyzes the ATP-dependent amidation of D-glutamate residue of lipid II, converting it to an isoglutamine residue"
],
"length": 420,
"sequence": "MSFNLRTRLAIGAAAVATTASRATGRGSGGMIGGLIAEKIDPNIMQSLAKTRPTALVTGTNGKSTTTRMLASAVRTQHTVATNEGGDNMDAGIISALMAGQSASHVVLEVDELHVPSAADRLHPECLILLNLTRDQLDRVGEINKIERALRDCVTAHPDMTVIANCDDVLVTSVAYDAPNVVWVSAGAGWTGDSVSCPRTGSHIVRQDDHWYATKPLPNGETFQRPTPAWTITPDGILAPGHTEPVPLSLALPGNANRGNATQAIAAAVTCFDVPLDDAVRAVETVDDVAGRYSTITLGEHHIHLLLAKNPAGWQEALSMVDRTAEGLVIAVNGQVADGEDLSWLWDVKFEELEELSVKAAGERGTDLSVRLTYASVDHELVRDPLAAIKACPAGRVEVLANYTAFRDLKRAITAATKEA",
"proteome": null,
"gene": "murT",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016881",
"name": "acid-amino acid ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016874",
"name": "ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009252",
"name": "peptidoglycan biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f5e5e53a9929d24044286325e2d17e7b47a8ed56",
"counters": {
"domain_architectures": 6522,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"hamap": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6522
}
}
}