GET /api/protein/UniProt/A0A6I8M9P3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8M9P3",
        "id": "A0A6I8M9P3_9CORY",
        "source_organism": {
            "taxId": "2719119",
            "scientificName": "Corynebacterium rouxii",
            "fullName": "Corynebacterium rouxii"
        },
        "name": "Lipid II isoglutaminyl synthase (glutamine-hydrolyzing) subunit MurT",
        "description": [
            "The lipid II isoglutaminyl synthase complex catalyzes the formation of alpha-D-isoglutamine in the cell wall lipid II stem peptide. The MurT subunit catalyzes the ATP-dependent amidation of D-glutamate residue of lipid II, converting it to an isoglutamine residue"
        ],
        "length": 420,
        "sequence": "MSFNLRTRLAIGAAAVATTASRATGRGSGGMIGGLIAEKIDPNIMQSLAKTRPTALVTGTNGKSTTTRMLASAVRTQHTVATNEGGDNMDAGIISALMAGQSASHVVLEVDELHVPSAADRLHPECLILLNLTRDQLDRVGEINKIERALRDCVTAHPDMTVIANCDDVLVTSVAYDAPNVVWVSAGAGWTGDSVSCPRTGSHIVRQDDHWYATKPLPNGETFQRPTPAWTITPDGILAPGHTEPVPLSLALPGNANRGNATQAIAAAVTCFDVPLDDAVRAVETVDDVAGRYSTITLGEHHIHLLLAKNPAGWQEALSMVDRTAEGLVIAVNGQVADGEDLSWLWDVKFEELEELSVKAAGERGTDLSVRLTYASVDHELVRDPLAAIKACPAGRVEVLANYTAFRDLKRAITAATKEA",
        "proteome": null,
        "gene": "murT",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016881",
                "name": "acid-amino acid ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016874",
                "name": "ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009252",
                "name": "peptidoglycan biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f5e5e53a9929d24044286325e2d17e7b47a8ed56",
        "counters": {
            "domain_architectures": 6522,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6522
        }
    }
}