HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I6NN36",
"id": "A0A6I6NN36_9ACTN",
"source_organism": {
"taxId": "2686304",
"scientificName": "Streptomyces broussonetiae",
"fullName": "Streptomyces broussonetiae"
},
"name": "Ribosomal RNA large subunit methyltransferase G",
"description": [
"Specifically methylates the guanine in position 1835 (m2G1835) of 23S rRNA"
],
"length": 377,
"sequence": "MTTPWGEVDLTRFPEDPRDPLRAWDASDAYLLRHLAEEGVPLTGTVVVVGDRWGALATALAEHRPTQITDSFLGQEATRANLARAGVEPGAVQLLTTQDPPPERVDVLLVRVPKSLALLEDQLLRLAPAVHADTVVVGTGMVKEIHTSTLQLFERVLGPTRTSLARQKARLIFCTPDPALERPANPWPYSYGLPDGIGAASGRTVVNHAGVFCADRLDIGTRFFLTHLPGPGAARVVDLGCGNGVVGTAVALADPAAEVLFVDESFQAVASAEATYKANGVPGHAEFRVGDGLAGVAPGSVDLVLNNPPFHAHQATTDATAWRMFTGAQRALRPGGELWVIGNRHLGYHVKLRRLFGNSELVASDPKFVVLRAVKKD",
"proteome": "UP000436138",
"gene": "rlmG",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008990",
"name": "rRNA (guanine-N2-)-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0031167",
"name": "rRNA methylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0008757",
"name": "S-adenosylmethionine-dependent methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0032259",
"name": "methylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1cc78d70ab7932acb990d69c677fd6c44b929a70",
"counters": {
"domain_architectures": 5315,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5315
}
}
}