HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I6JKY1",
"id": "A0A6I6JKY1_9BACT",
"source_organism": {
"taxId": "2678688",
"scientificName": "Pseudodesulfovibrio cashew",
"fullName": "Pseudodesulfovibrio cashew"
},
"name": "3-isopropylmalate dehydrogenase",
"description": [
"Catalyzes the oxidation of 3-carboxy-2-hydroxy-4-methylpentanoate (3-isopropylmalate) to 3-carboxy-4-methyl-2-oxopentanoate. The product decarboxylates to 4-methyl-2 oxopentanoate"
],
"length": 355,
"sequence": "MKICVLPGDGIGPEIVAQGLRVLDAVGEKFGRTFETTEALIGGAAIDAAGEPLPAETVAKCKDADAVLLGAVGGPKWDTIDPAIRPEKGLLGIRKALGLFANLRPAKLFPQLADACYLRPDIVARGLDVMVVRELTGGIYFGEPRFDGEKDGERFGYNTMTYYEHEIRRIAKLAFEAARKRSGRVCSVDKANVLDVSRVWREIVIDEHKNYADVELEHLYVDNAAMQLVRDPSQFDVIVTGNLFGDILSDEAAAITGSIGMLPSASLGAENPGLYEPIHGSAPDIAGQDKANPLATILSVSMMLRHAFDMAEEADCMEQAVEKTLEQGYRTGDIWQEGGKSVGCTAMADAVLANL",
"proteome": "UP000428328",
"gene": "leuB",
"go_terms": [
{
"identifier": "GO:0003862",
"name": "3-isopropylmalate dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009098",
"name": "L-leucine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051287",
"name": "NAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c0dd027c099af1b1fcd3352f0b400bd0f7d5c9c5",
"counters": {
"domain_architectures": 89688,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"pfam": 1,
"ssf": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 89688
}
}
}