GET /api/protein/UniProt/A0A6G1Q3C6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6G1Q3C6",
        "id": "A0A6G1Q3C6_CHAAH",
        "source_organism": {
            "taxId": "215402",
            "scientificName": "Channa argus",
            "fullName": "Channa argus (Northern snakehead)"
        },
        "name": "YTH domain-containing family protein",
        "description": [
            "Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in mRNA stability and processing"
        ],
        "length": 618,
        "sequence": "MSATSIDPQRSKGQASKVQNGSLHQKETVHDNDFEPYLTSQSTQNNSYQSITDPYLSSYYAPSIGFPYPLNEAPWSTGGDPPIPYLTPYGPLSNGDHHFMPDTVFGQPGGLGSSIYPHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGGSYSYPPSSLGGTLVADGQTGFHNDTLNKAPGMNSLEQGMVGLKIGGDVTGQGTAVKAVGSVIGGPAVAATGNGATPIGMPPPKPTSWAAIASKPAKPQQLRAKVKPGMPNPGGALPPPPIKHNMNIGTWDKGPVTKIATAPLQPPQHPLGLPHAMPPQAPTQQGPMQPPPPQSLVQAQMQPMALQPQPPHHQHHQPPPQPYQNHTQPPQPQTRWVAPRNRNQGYGQGGPGQDGSGVMGVVGSGNNGPHNSASQGPGGESHPVLEKLRASHSYNPKEFEWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAMNGKGPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATYKHTTSIFDDFSHYEKRQEEEEEVRKTFEPAQIQNRSRLDQERPNRNKQ",
        "proteome": "UP000503349",
        "gene": "EXN66_Car012682",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c9c510044cb31edcbf457fb18959cdae896850d",
        "counters": {
            "domain_architectures": 16036,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16036
        }
    }
}