General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6G1Q2D4",
        "id": "A0A6G1Q2D4_CHAAH",
        "source_organism": {
            "taxId": "215402",
            "scientificName": "Channa argus",
            "fullName": "Channa argus (Northern snakehead)"
        },
        "name": "Bactericidal permeability-increasing protein",
        "description": [
            "The cytotoxic action of BPI is limited to many species of Gram-negative bacteria; this specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram-negative bacterial outer envelope"
        ],
        "length": 485,
        "sequence": "MCCFHQRGHSNMLLSVLLLFTSLSCTCGENPAIQFILSNKGLQYGKHVGTDWIQESLERVTFPDISGEVDIGLLGSIDYTLSDITIIKCDLPEPTVEFYPDATGFKTSVQGLSIALTGGWRTHYHIIDISGSFEMAIFNINVVSVVELGKDPNGHLSVSSVSCDADVGDVDIQFHGGASWIFQPFVRYFKRHITNEIQRNICPNVKGILVNLESYLQSMNVSFDVDQVLTLDLPLTGLPVINASGLNLGFKGEFYNIKTHMEPPFKAQPFTMSEQQGYMFSVGVSEFTLNSAAYAYYSAGLFQADINDSTVFQYVHVHLNTTTVGKFIPQLPHMFPDQLMSLKFYAREVPVFSFQPDAVKLGFQGAVKAFALQPNGTQSPLFTLSFDSKFSGKMYISGERLKGSIQMDNFTLTLAASEVGTFKTDALEKVLTIGIKFNVVTQVNKKLGEGFPLPRMKRAQLVNSVLNVEEGFIAMSSDAEVVLTD",
        "proteome": "UP000503349",
        "gene": "EXN66_Car012363",
        "go_terms": [
            {
                "identifier": "GO:0008289",
                "name": "lipid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005615",
                "name": "extracellular space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "039037fd0dd39e90081151ccec5366a75852e8a8",
        "counters": {
            "domain_architectures": 6576,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 2,
                "smart": 2,
                "pfam": 2,
                "panther": 1,
                "pirsf": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6576
        }
    }
}