GET /api/protein/UniProt/A0A6G0HV96/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6G0HV96",
        "id": "A0A6G0HV96_LARCR",
        "source_organism": {
            "taxId": "215358",
            "scientificName": "Larimichthys crocea",
            "fullName": "Larimichthys crocea (Large yellow croaker)"
        },
        "name": "AAA+ ATPase domain-containing protein",
        "description": [
            "Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Implicated in the regulation of centrosome duplication. Negatively regulates cilium formation and structure"
        ],
        "length": 293,
        "sequence": "MSDVPDNANEHCPGTQTIAEIGAKLSTVKHKILVLSGKGGVGKSTFSAHLAHALANDGTKEVALLDVDICGPSIPRIMGLEGEQVHQSGSGWSPVYVEENLAVMSIGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDLDYLIVDTPPGTSDEHLSIVQYLSSTHVDGAVIITTPQEVALQDVRKEIRFCQKVKLPIIGVVENMSGFVCPSCKNTSQIFPPTSGGAERMCENLKLPLLGKVPLDPRIARSCDEGKSFLNEVPDSPAAKAYHSIVQSIQDYCSNRVTDEQSTD",
        "proteome": "UP000424527",
        "gene": "NUBP1",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0140663",
                "name": "ATP-dependent FeS chaperone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3cbfa3de54076f1e90790dfecfba67c11e53357e",
        "counters": {
            "domain_architectures": 28831,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "hamap": 2,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28831
        }
    }
}