General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6F8YWS7",
        "id": "A0A6F8YWS7_9ACTN",
        "source_organism": {
            "taxId": "624315",
            "scientificName": "Phytohabitans suffuscus",
            "fullName": "Phytohabitans suffuscus"
        },
        "name": "Xylose transport system permease protein XylH",
        "description": [
            "Part of the binding-protein-dependent transport system for D-xylose. Probably responsible for the translocation of the substrate across the membrane"
        ],
        "length": 413,
        "sequence": "MTSTKPPPLASPASAPAAALHGGTSDPRTLILRNLRQSGIYIAFVVIVALFAFLTDGVLLSPGNITNIVLQYSYILVLAIGMVIVIIAGHIDLSVGSVVALTGAVSAVLVIQQGFPWWIGVAAALAVGVAVGAWHGFWVAYVGMPAFIVTLAGMLLFRGLTLQVLDNISLSPFPSEYQKVASGFLNGLLGGQGYDAFTLFIAAFAVIGYAISVFRTRLARIRYQQSVESFPLFVTRVLLVGAVVMYFAWQLANARGLPIVLIILAVLVIAYGLMTRSTVFGRQIYAIGGNLSAATLSGVKVRKVNFWIFVNMGLLAGVAGVIYSSRSNGAQPAAGNMFELDAIAAAFIGGAAVAGGVGTVVGAMVGGLIMAVMSNGMQLMGIDQSTQSVVKGLVLLLAVAFDIYNKRRAGATR",
        "proteome": "UP000503011",
        "gene": "Psuf_078520",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1f4945418929b9761eda031e21626d80f6bb8489",
        "counters": {
            "domain_architectures": 257120,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 257120
        }
    }
}