General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6F8V9H6",
        "id": "A0A6F8V9H6_9PROT",
        "source_organism": {
            "taxId": "2715678",
            "scientificName": "Sulfurimicrobium lacus",
            "fullName": "Sulfurimicrobium lacus"
        },
        "name": "33 kDa chaperonin",
        "description": [
            "Redox regulated molecular chaperone. Protects both thermally unfolding and oxidatively damaged proteins from irreversible aggregation. Plays an important role in the bacterial defense system toward oxidative stress"
        ],
        "length": 292,
        "sequence": "MENRDSLQRFMFEHAAVRGGIVHLDKTWQAVLERREYPPLLRNLLGEMMAAAALLAASLKFTGSIILQMQGEGPVKLVVVECQSDLTMRAMAHWEGEVVGELLAELLGAGRFAITVDPRDGGKTYQGVVAISGHSVADALEDYMSRSEQLETRLWLAADGNRAAGMLLQKMPGHDVDTDPDAWTRAVHFASTLTRKELLGLPATQTLHRLYHEEDVRVFDPQDVNFHCPCSRERVAGMLRLLGHDEVQALLSEQDSIEVDCEFCNRHYVFDKVDAEQAFASDVPTPAPKSLH",
        "proteome": "UP000502260",
        "gene": "hslO",
        "go_terms": [
            {
                "identifier": "GO:0051082",
                "name": "unfolded protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006457",
                "name": "protein folding",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "917d256e30da7b551bcfa821200c942059e8854a",
        "counters": {
            "domain_architectures": 16046,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16046
        }
    }
}